PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_31327
Common NameKK1_030480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Dof
Protein Properties Length: 319aa    MW: 34361.9 Da    PI: 9.3862
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_31327genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.5e-3956116262
         zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  C.cajan_31327  56 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 116
                    7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.3E-3458114IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2759114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52560114IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106298IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MSDNSAKMVL IPPTTNQWPQ VDDHKVLMGS SGGSNNNNNN SKVMEKRGQE ILQQQQQQAL  60
KCPRCDSSNT KFCYYNNYSL SQPRHFCKAC KRYWTRGGTL RNVPVGGGCR KNKRVKRPIT  120
NPSSAAAAAI DTASNSSSSS APTATSQPQI DTASTSNHIN PLFYGLPSSS SDVNVNLPLF  180
PRFGSRISSS GFDLQLNDAL GLGFSSGVVS NEASDNNNGY RNGFGSNNTL LSSYNSIFGS  240
STSSSTATTP SMPSLLLQQK FMSGGLKDGQ SNRLEWNNGA CQNQIQHVGL YDPSLYWNNT  300
VGVWNDQAAN IGSSVTSLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148145.11e-147hypothetical protein PHAVU_006G184000g
TrEMBLA0A151RZ650.0A0A151RZ65_CAJCA; Dof zinc finger protein DOF1.4
STRINGGLYMA15G08250.11e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.16e-41Dof family protein